The CSF2 domain within your query sequence starts at position 18 and ends at position 135, and its E-value is 2.1e-69.

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFEC
CSF2

CSF2

Granulocyte-macrophage colony-simulating factor (GM-CSF)
SMART ACC:SM000040
Description:GM-CSF stimulates the development of and the cytotoxic activity of white blood cells.
InterPro ACC:IPR000773
InterPro abstract:

Granulocyte-macrophage colony-stimulating factor (GMCSF) is a cytokine that acts in hematopoiesis to stimulate growth and differentiation of hematopoietic precursor cells from various lineages including granulocytes, macrophages, eosinophils and erythrocytes [ PUBMED:2458827 PUBMED:1569568 expand

GO process:immune response (GO:0006955)
GO component:extracellular region (GO:0005576)
GO function:growth factor activity (GO:0008083), granulocyte macrophage colony-stimulating factor receptor binding (GO:0005129)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 76 CSF2 domains in 76 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CSF2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CSF2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the CSF2 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CSF2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing CSF2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITECSF2_DOMAIN
InterProIPR000773