The SEL1 domain within your query sequence starts at position 588 and ends at position 623, and its E-value is 4.55e-9.

AQAMFNLAYMYEHGLGIAKDIHLARRLYDMAAQTSP
SEL1

SEL1

Sel1-like repeats.
SMART ACC:SM000671
Description:These represent a subfamily of TPR (tetratricopeptide repeat) sequences.
InterPro ACC:IPR006597
InterPro abstract:

Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway [ PUBMED:8722778 ]. Mammalian homologues have since been identified although these mainly pancreatic proteins have yet to have a function assigned. … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 285 851 SEL1 domains in 57 166 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SEL1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SEL1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Unknown

Relevant references for this domain

Primary literature for the SEL1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SEL1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing SEL1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006597