The IBR domain within your query sequence starts at position 251 and ends at position 329, and its E-value is 4.95e-2.

ARQQRAQTLRVRTKHTSGLSYGQESGPDDIKPCPRCSAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISDLHYLSPSGC
IBR

IBR

In Between Ring fingers
SMART ACC:SM000647
Description:the domains occurs between pairs og RING fingers
InterPro ACC:IPR002867
InterPro abstract:

The IBR (In Between Ring fingers) domain is often found to occur between pairs of ring fingers. This domain has also been called the C6HC domain and DRIL (for double RING finger linked) domain [ PUBMED:10422847 ]. Proteins that contain two Ring fingers and an IBR domain (these proteins are also termed RBR family proteins) … expand

GO function:zinc ion binding (GO:0008270)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 28 130 IBR domains in 15 655 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IBR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IBR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IBR domain which could be assigned to a KEGG orthologous group, and not all proteins containing IBR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamIBR
InterProIPR002867