The KASH domain within your query sequence starts at position 335 and ends at position 388, and its E-value is 2.85e-15.

ASKRPLTLFFLLLFLLLVGATLLLPLSGVSCCSHARLARTPYLVLSYVNGLPPI
KASH

KASH

Nuclear envelope localisation domain
SMART ACC:SM001249
Description:The KASH (for Klarsicht/ANC-1/Syne-1 homology) or KLS domain is a highly hydrophobic nuclear envelope localisation domain of approximately 60 amino acids comprising a 20-amino-acid transmembrane region and a 30-35-residue C-terminal region that lies between the inner and the outer nuclear membranes (PMID:12169658). During meiotic prophase, telomeres cluster to form a bouquet arrangement of chromosomes. SUN and KASH domain proteins form complexes that span both membranes of the nuclear envelope. The KASH domain links the dynein motor complex of the microtubules, through the outer nuclear membrane to the Sad1 domain in the inner nuclear membrane which then interacts with the bouquet proteins Bqt1 and Bqt2 that are complexed with Bqt4, Rap1 and Taz1 and attached to the telomere (PMID:19948484). SUN domain-containing proteins are essential for recruiting KASH domain proteins at the outer nuclear membrane, and KASH domains provide a generic NE tethering device for functionally distinct proteins whose cytoplasmic domains mediate nuclear positioning, maintain physical connections with other cellular organelles, and possibly even influence chromosome dynamics (PMID:19687252).
InterPro ACC:IPR012315
InterPro abstract:

The KASH (Klarsicht/ANC-1/Syne-1 homology), or KLS domain is a highly hydrophobic nuclear envelope localization domain of approximately 60 amino acids comprising a 20-amino-acid transmembrane region and a 30-35-residue C-terminal region that lies between the inner and the outer nuclear membranes. The KASH domain is found in association with other domains, such as spectrin repeats and CH, at the … expand

GO component:membrane (GO:0016020)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 418 KASH domains in 2 416 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing KASH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing KASH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the KASH domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a KASH domain which could be assigned to a KEGG orthologous group, and not all proteins containing KASH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamKASH
InterProIPR012315