The FIST_C domain within your query sequence starts at position 231 and ends at position 365, and its E-value is 2.61e-6.

ASNYLHRVVSTFSDMNIILAGGQVDNLSSLTCEKNPLDIDATGVVGLSFSGHRIQSATVLLTEDVNDAKTVEAAMQRLKAANIPEQNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGNGEIGCD
FIST_C

FIST_C

SMART ACC:SM001204
Description:The FIST C domain is a novel sensory domain, which is present in signal transduction proteins from Bacteria, Archaea and Eukarya. Chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such as amino acids. PMID:17855421
InterPro ACC:IPR019494
InterPro abstract:

This entry represents a novel sensory domain, designated FIST_C (short for F-box and intracellular signal transduction, C-terminal), which is present in signal transduction proteins from bacteria, archaea and eukaryotes. The chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 371 FIST_C domains in 7 366 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FIST_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FIST_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the FIST_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FIST_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing FIST_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamFIST_C
InterProIPR019494