The GIDA_assoc_3 domain within your query sequence starts at position 5 and ends at position 78, and its E-value is 8.31e-26.

ASYESVLSYQLQEIKEVQQDEALQLPHELDYLTIRDVSLSQEVREKLHLSRPQTIGAASRIPGVTPAAIINLLR
GIDA_assoc_3

GIDA_assoc_3

GidA associated domain 3
SMART ACC:SM001228
Description:The GidA associated domain 3 is a motif that has been identified at the C-terminus of protein GidA. It consists of 4 helices, the last three being rather short and forming small bundle at the top end of the first longer one. It is here named helical domain 3 because in GidA it is preceded by two other C-terminal helical domain (based on crystal structures PMID:18565343, 19446527). GidA is an tRNA modification enzyme found in bacteria and mitochondrial. Based on mutational analysis this domain has been suggested to be implicated in binding of the D-stem of tRNA (PMID:19446527) and to be responsible for the interaction with protein MnmE PMID:18565343. Structures of GidA in complex with either tRNA or MnmE are missing. Reported to bind to Pfam family MnmE, PF12631.
InterPro ACC:IPR047001
InterPro abstract:

This entry represents the C-terminal subdomain of MnmG (also known as GidA). It consists of the last highly conserved 3 helices of the C-terminal domain, which are rather short and form a small bundle [ PUBMED:18565343 PUBMED:19446527 ]. MnmG … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 18 150 GIDA_assoc_3 domains in 18 150 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GIDA_assoc_3 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GIDA_assoc_3 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

Relevant references for this domain

Primary literature for the GIDA_assoc_3 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GIDA_assoc_3 domain which could be assigned to a KEGG orthologous group, and not all proteins containing GIDA_assoc_3 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamGIDA_assoc_3
InterProIPR047001