The IBN_N domain within your query sequence starts at position 24 and ends at position 90, and its E-value is 4.4e-7.

ATEQLQTILRDPAALPALFDLLATATDSQIRQFAAVLTRRRLNNRWRRLAPEQRESLKSLVLTALQK
IBN_N

IBN_N

Importin-beta N-terminal domain
SMART ACC:SM000913
Description:Members of the importin-beta (karyopherin-beta) family can bind and transport cargo by themselves, or can form heterodimers with importin-alpha. As part of a heterodimer, importin-beta mediates interactions with the pore complex, while importin-alpha acts as an adaptor protein to bind the nuclear localisation signal (NLS) on the cargo through the classical NLS import of proteins. Importin-beta is a helicoidal molecule constructed from 19 HEAT repeats. Many nuclear pore proteins contain FG sequence repeats that can bind to HEAT repeats within importins (PUBMED:12372823), (PUBMED:17161424), which is important for importin-beta mediated transport.
InterPro ACC:IPR001494
InterPro abstract:

This entry represents the N-terminal domain of importin-beta (also known as karyopherins-beta) that is important for the binding of the Ran GTPase protein [ PUBMED:10367892 ].

Members of the importin-beta (karyopherin-beta) family can bind and transport cargo by themselves, or can form heterodimers with importin-alpha. … expand

GO process:intracellular protein transport (GO:0006886)
GO function:small GTPase binding (GO:0031267)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 16 376 IBN_N domains in 16 251 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IBN_N domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IBN_N domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:

Relevant references for this domain

Primary literature for the IBN_N domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IBN_N domain which could be assigned to a KEGG orthologous group, and not all proteins containing IBN_N domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001494
PfamIBN_N