The tRNA_SAD domain within your query sequence starts at position 233 and ends at position 282, and its E-value is 1.15e-10.

ATVYGCGMSVDLCRGPHLRHTGQIGALKLLTNSSALWRSLGAPETLQRVS
tRNA_SAD

tRNA_SAD

Threonyl and Alanyl tRNA synthetase second additional domain
SMART ACC:SM000863
Description:The catalytically active form of threonyl/alanyl tRNA synthetase is a dimer. Within the tRNA synthetase class II dimer, the bound tRNA interacts with both monomers making specific interactions with the catalytic domain, the C-terminal domain, and this SAD domain (the second additional domain). The second additional domain is comprised of a pair of perpendicularly orientated antiparallel beta sheets, of four and three strands, respectively, that surround a central alpha helix that forms the core of the domain.
InterPro ACC:IPR012947
InterPro abstract:

The catalytically active form of threonyl/alanyl tRNA synthetase is a dimer. Within the tRNA synthetase class II dimer, the bound tRNA interacts with both monomers making specific interactions with the catalytic domain, the C-terminal domain, and this SAD domain (the second additional domain). The second additional domain is comprised of a pair of perpendicularly orientated antiparallel β sheets … expand

GO process:tRNA aminoacylation (GO:0043039)
GO function:ATP binding (GO:0005524), aminoacyl-tRNA ligase activity (GO:0004812)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 57 173 tRNA_SAD domains in 57 163 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing tRNA_SAD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing tRNA_SAD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

Relevant references for this domain

Primary literature for the tRNA_SAD domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a tRNA_SAD domain which could be assigned to a KEGG orthologous group, and not all proteins containing tRNA_SAD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamtRNA_SAD
InterProIPR012947