The JAB_MPN domain within your query sequence starts at position 11 and ends at position 178, and its E-value is 3.77e-41.

AVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDIRSDSKFTYTGTEMRTVQEKMDTIRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQA
JAB_MPN

JAB_MPN

JAB/MPN domain
SMART ACC:SM000232
Description:Domain in Jun kinase activation domain binding protein and proteasomal subunits. Domain at Mpr1p and Pad1p N-termini. Domain of unknown function.
InterPro ACC:IPR000555
InterPro abstract:

This domain is known as the MPN domain [ PUBMED:9644972 ], PAD-1-like domain [ PUBMED:10369758 ], JABP1 domain [ PUBMED:20838651 ] or JAMM domain [ expand

GO function:metallopeptidase activity (GO:0008237), protein binding (GO:0005515), peptidase activity (GO:0008233)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 21 169 JAB_MPN domains in 21 159 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing JAB_MPN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing JAB_MPN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the JAB_MPN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a JAB_MPN domain which could be assigned to a KEGG orthologous group, and not all proteins containing JAB_MPN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000555