The PRY domain within your query sequence starts at position 430 and ends at position 481, and its E-value is 1.4e-2.

AYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPESPTRFTHCEQVLGEGALD
PRY

PRY

SMART ACC:SM000589
Description:associated with SPRY domains
InterPro ACC:IPR006574
InterPro abstract:

PRY is a 50-60 amino acids domain associated with SPRY domains, adjacent to its N-terminal. The SPRY domain ( IPR003877 ) is a protein-protein interaction module involved in many important signaling pathways [ PUBMED:23139046 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 24 551 PRY domains in 24 280 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PRY domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PRY domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PRY domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PRY domain which could be assigned to a KEGG orthologous group, and not all proteins containing PRY domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006574