The Cg6151-P domain within your query sequence starts at position 53 and ends at position 118, and its E-value is 8.02e-10.

CAISGLFNCVTIHPLNIAAGVWMIMNAFILLLCEAPFCCQFVEFANTVAEKVDRLRSWQKAVFYCG
Cg6151-P

Cg6151-P

Uncharacterized conserved protein CG6151-P
SMART ACC:SM001077
Description:This is a family of small, less than 200 residue long, proteins which are named as CG6151-P proteins that are conserved from fungi to humans. The function is unknown. The fungal members have a characteristic ICP sequence motif. Some members are annotated as putative clathrin-coated vesicle protein but this could not be defined.
InterPro ACC:IPR019365
InterPro abstract:

This is a family of small (less than 200 residue long) proteins that are conserved from fungi to humans. Family members include the TVP18 Golgi membrane proteins that are involved in vesicular trafficking [ PUBMED:17178117 ] and the calcium channel flower proteins, which form calcium channels that regulate synaptic endocytosis … expand

GO component:membrane (GO:0016020)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 212 Cg6151-P domains in 1 212 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Cg6151-P domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Cg6151-P domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Cg6151-P domain which could be assigned to a KEGG orthologous group, and not all proteins containing Cg6151-P domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Links to other resources describing this domain

InterProIPR019365
PfamCg6151-P