The ANATO domain within your query sequence starts at position 36 and ends at position 69, and its E-value is 3.67e-9.

CCTDGNQMANQHRDCSLPYTSESKECRMVQEQCC
ANATO

ANATO

Anaphylatoxin homologous domain
SMART ACC:SM000104
Description:C3a, C4a and C5a anaphylatoxins are protein fragments generated enzymatically in serum during activation of complement molecules C3, C4, and C5. They induce smooth muscle contraction. These fragments are homologous to a three-fold repeat in fibulins.
InterPro ACC:IPR000020
InterPro abstract:

This entry represents C3a, C4a and C5a anaphylatoxins, which are protein fragments generated enzymatically in serum during activation of complement molecules C3, C4, and C5. They induce smooth muscle contraction. These fragments are homologous to a three-fold repeat in fibulins.

Complement components C3, C4 and C5 are large glycoproteins that have important functions in the immune response … expand

GO component:extracellular region (GO:0005576)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 026 ANATO domains in 2 261 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ANATO domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ANATO domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ANATO domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the ANATO domain.

ProteinDescriptionDisease / phenotype
CO4A_HUMANOMIM:120810 : C4 deficiency
OMIM:120820 : C4 deficiency

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ANATO domain which could be assigned to a KEGG orthologous group, and not all proteins containing ANATO domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEANATO_DOMAIN
InterProIPR000020