The PTPc_DSPc domain within your query sequence starts at position 1 and ends at position 97, and its E-value is 7.6e-3.

CEHYWPVNSTPVTHGHITTHLLAEESEDEWTRREFQLQHGAEQKQRHVKQLQFTTWPDHSVPEAPSSLLAFVELVQEEVKATQGKGPILVHCSAGVG
PTPc_DSPc

PTPc_DSPc

Protein tyrosine phosphatase, catalytic domain, undefined specificity
SMART ACC:SM000012
Description:Protein tyrosine phosphatases. Homologues detected by this profile and not by those of "PTPc" or "DSPc" are predicted to be protein phosphatases with a similar fold to DSPs and PTPs, yet with unpredicted specificities.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 306 PTPc_DSPc domains in 296 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PTPc_DSPc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PTPc_DSPc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Protein tyrosine phosphatase

Relevant references for this domain

Primary literature for the PTPc_DSPc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PTPc_DSPc domain which could be assigned to a KEGG orthologous group, and not all proteins containing PTPc_DSPc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain