The CARP domain within your query sequence starts at position 27 and ends at position 64, and its E-value is 8.74e-12.

CENCNIYIFDHSATITIDDCTNCVIFLGPVKGSVFFRN
CARP

CARP

Domain in CAPs (cyclase-associated proteins) and X-linked retinitis pigmentosa 2 gene product.
SMART ACC:SM000673
Description: -
InterPro ACC:IPR006599
InterPro abstract:

This entry represents the CARP motif, which occurs as a tandem repeat in the C-terminal of many cyclase-associated proteins (CAPs), as well as in tubulin binding cofactor C and the X-linked retinitis pigmentosa 2 protein (RP2).

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 477 CARP domains in 5 087 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CARP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CARP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Proper folding of tubulin?

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CARP domain which could be assigned to a KEGG orthologous group, and not all proteins containing CARP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006599