The CUB domain within your query sequence starts at position 817 and ends at position 928, and its E-value is 3.09e-25.

CGGELRGEGVIRSPFYPNAYAGRRTCRWTISQPPREVVLLNFTDFQIGSSSSCDTDYIEIGPSSVLGSPGNEKFCGTNIPSFITSVYNVLYVTFVKSSSMENRGFMAMFSSE
CUB

CUB

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein.
SMART ACC:SM000042
Description:This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.
InterPro ACC:IPR000859
InterPro abstract:

The CUB domain (for complement C1r/C1s, Uegf, Bmp1) is a structural motif of approximately 110 residues found almost exclusively in extracellular and plasma membrane-associated proteins, many of which are developmentally regulated [ PUBMED:8510165 PUBMED:2026272 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 84 744 CUB domains in 33 329 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CUB domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CUB domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the CUB domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CUB domain which could be assigned to a KEGG orthologous group, and not all proteins containing CUB domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITECUB_DOMAIN
InterProIPR000859
PfamCUB