The C1Q domain within your query sequence starts at position 152 and ends at position 287, and its E-value is 3.96e-46.

CGSSRAKSAFSVAVTKSYPRERLPIKFDKILMNEGGHYNASSGKFVCSVPGIYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTILALKEGDEVWLQIFYSEQNGLFYDPYWTDSLFTGFLIYAD
C1Q

C1Q

Complement component C1q domain.
SMART ACC:SM000110
Description:Globular domain found in many collagens and eponymously in complement C1q. When part of full length proteins these domains form a 'bouquet' due to the multimerization of heterotrimers. The C1q fold is similar to that of tumour necrosis factor.
InterPro ACC:IPR001073
InterPro abstract:

This entry represents the C-terminal domain of C1q. C1q is a subunit of the C1 enzyme complex that activates the serum complement system. C1q comprises 6 A, 6 B and 6 C chains. These share the same topology, each possessing a small, globular N-terminal domain, a collagen-like Gly/Pro-rich central region, and a conserved C-terminal region, the C1q domain [ PUBMED:1706597 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 593 C1Q domains in 9 170 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing C1Q domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing C1Q domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the C1Q domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the C1Q domain.

ProteinDescriptionDisease / phenotype
COAA1_HUMANOMIM:120110 : Metaphyseal chondrodysplasia, Schmid type ; Spondylometaphyseal dysplasia, Japanese type

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a C1Q domain which could be assigned to a KEGG orthologous group, and not all proteins containing C1Q domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001073
PROSITEC1Q_DOMAIN
PfamC1q