The APPLE domain within your query sequence starts at position 291 and ends at position 376, and its E-value is 1.04e-30.

CHPSFYNDTDFLGEELDIVDVKGQETCQKTCTNNARCQFFTYYPSHRLCNERNRRGRCYLKLSSNGSPTRILHGRGGISGYSLRLC
APPLE

APPLE

APPLE domain
SMART ACC:SM000223
Description:Four-fold repeat in plasma kallikrein and coagulation factor XI. Factor XI apple 3 mediates binding to platelets. Factor XI apple 1 binds high-molecular-mass kininogen. Apple 4 in factor XI mediates dimer formation and binds to factor XIIa. Mutations in apple 4 cause factor XI deficiency, an inherited bleeding disorder.
InterPro ACC:IPR000177
InterPro abstract:

Plasma kallikrein ( EC:3.4.21.34 ) and coagulation factor XI ( EC:3.4.21.27 ) are two related plasma serine proteases activated by factor XIIA and which share the same domain topology: an N-terminal region that contains four tandem repeats of about 90 amino … expand

GO process:proteolysis (GO:0006508)
GO component:extracellular region (GO:0005576)
GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 067 APPLE domains in 698 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing APPLE domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing APPLE domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the APPLE domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the APPLE domain.

ProteinDescriptionDisease / phenotype
FA11_HUMANOMIM:264900 : Factor XI deficiency

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a APPLE domain which could be assigned to a KEGG orthologous group, and not all proteins containing APPLE domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEAPPLE
InterProIPR000177
Pfamapple