The Aldolase_II domain within your query sequence starts at position 135 and ends at position 317, and its E-value is 2.9e-48.

CKISSVYRLLDLYGWAQLSDTYVTLRVSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSSCFPVDTTGFSLHSAIYAARPDVRCAIHLHTPATAAVSAMKCGLLPVSHNALLVGDMAYYDFNGEMEQEADRINLQKCLGPTCKILVLRNHGMVALGDTVEEAFYKVFHLQAACEVQV
Aldolase_II

Aldolase_II

Class II Aldolase and Adducin N-terminal domain
SMART ACC:SM001007
Description:This family includes class II aldolases and adducins which have not been ascribed any enzymatic function.
InterPro ACC:IPR001303
InterPro abstract:

This entry represents the α/β/α domain found in class II aldolases and in adducin (usually at the N terminus of adducin). Proteins containing this domain include: rhamnulose-1-phosphate aldolase ( EC:4.1.2.19 ), L-fuculose phosphate aldolase ( EC:4.1.2.17 ) [ … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 44 565 Aldolase_II domains in 44 355 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Aldolase_II domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Aldolase_II domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the Aldolase_II domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Aldolase_II domain which could be assigned to a KEGG orthologous group, and not all proteins containing Aldolase_II domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001303
PfamAldolase_II