The TRASH domain within your query sequence starts at position 772 and ends at position 810, and its E-value is 4.48e-2.

CKMCSYCLQTSPKLIQNNLGGKVEDFCCEECMSKYTVLF
TRASH

TRASH

metallochaperone-like domain
SMART ACC:SM000746
Description: -
InterPro ACC:IPR011017
InterPro abstract:

TRASH domain contains a well-conserved cysteine motif that may be involved in metal coordination. TRASH is encoded by multiple prokaryotic genomes and is present in transcriptional regulators, cation-transporting ATPases and hydrogenases, and is also present as a stand-alone module. The observed domain associations and conserved genome context of TRASH-encoding genes in prokaryotic genomes suggest … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 24 136 TRASH domains in 7 020 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TRASH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TRASH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the TRASH domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TRASH domain which could be assigned to a KEGG orthologous group, and not all proteins containing TRASH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR011017
PfamYHS domain