The IL1 domain within your query sequence starts at position 34 and ends at position 175, and its E-value is 2.88e-70.

CKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQ
IL1

IL1

Interleukin-1 homologues
SMART ACC:SM000125
Description:Cytokines with various biological functions. Interluekin 1 alpha and beta are also known as hematopoietin and catabolin.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 006 IL1 domains in 2 001 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IL1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IL1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the IL1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IL1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing IL1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEIL1_DOMAIN