The CLECT domain within your query sequence starts at position 85 and ends at position 195, and its E-value is 3e-23.

CKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCS
CLECT

CLECT

C-type lectin (CTL) or carbohydrate-recognition domain (CRD)
SMART ACC:SM000034
Description:Many of these domains function as calcium-dependent carbohydrate binding modules.
InterPro ACC:IPR001304
InterPro abstract:

A number of different families of proteins share a conserved domain which was first characterised in some animal lectins and which seem to function as a calcium-dependent carbohydrate-recognition domain [ PUBMED:3290208 PUBMED:8341801 ]. This … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 74 207 CLECT domains in 53 821 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CLECT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CLECT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the CLECT domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CLECT domain which could be assigned to a KEGG orthologous group, and not all proteins containing CLECT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITECLECT_DOMAIN
InterProIPR001304
Pfamlectin_c