The ENT domain within your query sequence starts at position 16 and ends at position 88, and its E-value is 2.44e-29.

CKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHKMNLSLY
ENT

ENT

SMART ACC:SM001191
Description:This presumed domain is named after Emsy N Terminus (ENT). Emsy is a protein that is amplified in breast cancer and interacts with BRCA2. The N terminus of this protein is found to be similar to other vertebrate and plant proteins of unknown function. This domain has a completely conserved histidine residue that may be functionally important.
InterPro ACC:IPR005491
InterPro abstract:

The EMSY N-terminal (ENT) domain is a ~90-residue module, which is unique in the human proteome, although multiple copies are found in Arabidopsis proteins. In the plant proteins, the ENT domains are accompanied by Agenet domains, plant specific homologues of Tudor domains [ PUBMED:14651845 PUBMED:12575993 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 347 ENT domains in 2 318 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ENT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ENT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ENT domain which could be assigned to a KEGG orthologous group, and not all proteins containing ENT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR005491
PfamENT