The BACK domain within your query sequence starts at position 146 and ends at position 248, and its E-value is 8.42e-36.

CLGISVLAECLDCPELKATADDFIHQHFTEVYKTDEFLQLDVKRVTHLLSQDTLTVRAEDQVYDAAVRWLKYDEPNRQPFMVDILAKVRFPLISKNFLSKTVQ
BACK

BACK

BTB And C-terminal Kelch
SMART ACC:SM000875
Description:The BACK domain is found juxtaposed to the BTB domain; they are separated by as little as two residues.
InterPro ACC:IPR011705
InterPro abstract:

This domain is found associated with BTB/POZ domain ( IPR000210 ) and Kelch repeats ( IPR006652 ). BTB (broad-complex, tramtrack and bric a brac) is a Kelch related domain, also known as the POZ domain [ PUBMED:16207353 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 27 812 BACK domains in 27 689 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BACK domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BACK domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Interaction (with the environment)

Relevant references for this domain

Primary literature for the BACK domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BACK domain which could be assigned to a KEGG orthologous group, and not all proteins containing BACK domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamBACK
InterProIPR011705