The CUE domain within your query sequence starts at position 160 and ends at position 202, and its E-value is 1.43e-15.

CNEEDLKAIQDMFPNMDREVIRSVLEAQRGNKDAAINSLLQMG
CUE

CUE

Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs)
SMART ACC:SM000546
Description:CUE domains also occur in two protein of the IL-1 signal transduction pathway, tollip and TAB2. Ponting (Biochem. J.) "Proteins of the Endoplasmic reticulum" (in press)
InterPro ACC:IPR003892
InterPro abstract:

This domain promotes intramolecular monoubiquitination and has a dual role in mono- and poly-ubiquitination recognition, being involved in binding ubiquitin-conjugating enzymes (UBCs) [ PUBMED:12573224 PUBMED:12628920 PUBMED:23665229 expand

GO function:ubiquitin binding (GO:0043130)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 656 CUE domains in 4 564 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CUE domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CUE domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the CUE domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CUE domain which could be assigned to a KEGG orthologous group, and not all proteins containing CUE domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003892