The S1 domain within your query sequence starts at position 1221 and ends at position 1282, and its E-value is 2.8e-3.

CPGQAIGVKTRLDNGVTGFIPTKFLSDKVVKRPEERVKVGMTVHCRIMKIDIEKFSADLTCR
S1

S1

Ribosomal protein S1-like RNA-binding domain
SMART ACC:SM000316
Description: -
InterPro ACC:IPR003029
InterPro abstract:

The S1 domain was originally identified in ribosomal protein S1 but is found in a large number of proteins involved in RNA metabolism. It belongs to the OB-fold family. The structure of the S1 RNA-binding domain from the Escherichia coli polynucleotide phosphorylase has been determined using NMR methods and consists of a five-stranded antiparallel β barrel. Conserved residues on one face of the … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 254 322 S1 domains in 154 091 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing S1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing S1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a S1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing S1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003029
PfamS1