The ZnF_NFX domain within your query sequence starts at position 677 and ends at position 710, and its E-value is 4.23e1.

CQNHTCMKECHKVTEVDSSTGKNKAGPECFHCEE
ZnF_NFX

ZnF_NFX

SMART ACC:SM000438
Description:Repressor of transcription
InterPro ACC:IPR000967
InterPro abstract:

Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a … expand

GO component:nucleus (GO:0005634)
GO function:zinc ion binding (GO:0008270)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 23 037 ZnF_NFX domains in 2 722 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZnF_NFX domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZnF_NFX domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ZnF_NFX domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZnF_NFX domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZnF_NFX domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

Pfamzf-NF-X1
InterProIPR000967