The GRAN domain within your query sequence starts at position 74 and ends at position 125, and its E-value is 1.32e-22.

CQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSC
GRAN

GRAN

Granulin
SMART ACC:SM000277
Description: -
InterPro ACC:IPR000118
InterPro abstract:

Metazoan granulins [ PUBMED:1542665 ] are a family of cysteine-rich peptides of about 6 Kd which may have multiple biological activity. A precursor protein (known as acrogranin) potentially encodes seven different forms of granulin (grnA to grnG) which are probably released by post-translational proteolytic processing. … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 935 GRAN domains in 1 625 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GRAN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GRAN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GRAN domain which could be assigned to a KEGG orthologous group, and not all proteins containing GRAN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEGRANULINS
InterProIPR000118
Pfamgranulin