The TNFR domain within your query sequence starts at position 34 and ends at position 72, and its E-value is 1.75e0.

CRQQEFKDRSGNCVLCKQCGPGMELSKECGFGYGEDAQC
TNFR

TNFR

Tumor necrosis factor receptor / nerve growth factor receptor repeats.
SMART ACC:SM000208
Description:Repeats in growth factor receptors that are involved in growth factor binding. TNF/TNFR
InterPro ACC:IPR001368
InterPro abstract:

A number of proteins, some of which are known to be receptors for growth factors, have been found to contain a cysteine-rich domain of about 110 to 160 amino acids in their N-terminal part, that can be subdivided into four (or in some cases, three) modules of about 40 residues containing 6 conserved cysteines. Some of the proteins containing this domain are listed below [ PUBMED:2174582 expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 32 859 TNFR domains in 11 619 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TNFR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TNFR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the TNFR domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TNFR domain which could be assigned to a KEGG orthologous group, and not all proteins containing TNFR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamTNFR_c6
PROSITETNFR_DOMAIN
InterProIPR001368