The AIRC domain within your query sequence starts at position 266 and ends at position 413, and its E-value is 8.36e-31.

CRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVSVAGRSNGLGPVLSGNTAYPVISCPPITPDWGAQDVWSSLRLPSGIGCSTILSPEGSAQFAAQIFGLNNHLVWAKLRASILNTWISL
AIRC

AIRC

AIR carboxylase
SMART ACC:SM001001
Description:Members of this family catalyse the decarboxylation of 1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR). This family catalyse the sixth step of de novo purine biosynthesis. Some members of this family contain two copies of this domain.
InterPro ACC:IPR000031
InterPro abstract:

The novo purine biosynthesis proceeds by two divergent paths. In bacteria, yeasts, and plants, 5-aminoimidazole ribonucleotide (AIR) is converted to 4-carboxy-AIR (CAIR) by two enzymes: N5-carboxy-AIR (N5-CAIR) synthetase (PurK) and N5-CAIR mutase (class I PurE). In animals, the conversion of AIR to CAIR requires a single enzyme, AIR carboxylase (class II PurE) [ PUBMED:7918411 expand

GO process:'de novo' IMP biosynthetic process (GO:0006189)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 23 473 AIRC domains in 23 424 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing AIRC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing AIRC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the AIRC domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a AIRC domain which could be assigned to a KEGG orthologous group, and not all proteins containing AIRC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamAIRC
InterProIPR000031