The NTR domain within your query sequence starts at position 25 and ends at position 199, and its E-value is 1.02e-133.

CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTW
NTR

NTR

Tissue inhibitor of metalloproteinase family.
SMART ACC:SM000206
Description:Form complexes with metalloproteinases, such as collagenases, and irreversibly inactivate them.
InterPro ACC:IPR001820
InterPro abstract:

Tissue inhibitors of metalloproteinases (TIMPs, [ PUBMED:2793861 PUBMED:1850705 PUBMED:1512267 PUBMED:22427646 expand

GO function:metalloendopeptidase inhibitor activity (GO:0008191)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 422 NTR domains in 1 421 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing NTR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing NTR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the NTR domain.

ProteinDescriptionDisease / phenotype
TIMP3_HUMANOMIM:188826 : Sorsby fundus dystrophy
OMIM:136900 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a NTR domain which could be assigned to a KEGG orthologous group, and not all proteins containing NTR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001820
PROSITETIMP_DOMAIN