The ZnF_AN1 domain within your query sequence starts at position 10 and ends at position 49, and its E-value is 2e-4.

CSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQ
ZnF_AN1

ZnF_AN1

AN1-like Zinc finger
SMART ACC:SM000154
Description:Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
InterPro ACC:IPR000058
InterPro abstract:

This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound α/β fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 a ubiquitin-like protein in Xenopus laevis [ PUBMED:8390387 expand

GO function:zinc ion binding (GO:0008270)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 860 ZnF_AN1 domains in 5 998 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZnF_AN1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZnF_AN1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ZnF_AN1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZnF_AN1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZnF_AN1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000058