The PTN domain within your query sequence starts at position 34 and ends at position 113, and its E-value is 4.2e-53.

CSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQC
PTN

PTN

Pleiotrophin / midkine family
SMART ACC:SM000193
Description:Heparin-binding domain family.
InterPro ACC:IPR000762
InterPro abstract:

Several extracellular heparin-binding proteins involved in regulation of growth and differentiation belong to a new family of growth factors. These growth factors are highly related proteins of about 140 amino acids that contain 10 conserved cysteines probably involved in disulphide bonds, and include pleiotrophin [ PUBMED:15121180 expand

GO function:growth factor activity (GO:0008083)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 691 PTN domains in 689 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PTN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PTN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PTN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PTN domain which could be assigned to a KEGG orthologous group, and not all proteins containing PTN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEPTN_DOMAIN
InterProIPR000762