The RasGEFN domain within your query sequence starts at position 64 and ends at position 186, and its E-value is 8.6e-14.

CTQSHVSADTLKKLVNHLVPSLQSGDPFFIPAFLSTYRRFATTLQVLNLLFKRYEYFRPNSEEDEQVKNTLCSFLNTWMDKNTEDFCQTSDLLPLNYLKTYLSMNMPDSDLNVRVTRLLTQLQ
RasGEFN

RasGEFN

Guanine nucleotide exchange factor for Ras-like GTPases; N-terminal motif
SMART ACC:SM000229
Description:A subset of guanine nucleotide exchange factor for Ras-like small GTPases appear to possess this domain N-terminal to the RasGef (Cdc25-like) domain. The recent crystal structureof Sos shows that this domain is alpha-helical and plays a "purely structural role" (Nature 394, 337-343).
InterPro ACC:IPR000651
InterPro abstract:

The N-terminal domain of guanine nucleotide exchange factor (GEF) for Ras-like GTPases is also called REM domain (Ras exchanger motif). REM contacts the GTPase and is assumed to participate in the catalytic activity of the exchange factor. Proteins with the REM domain include Sos1 and Sos2, which relay signals from tyrosine-kinase mediated signalling to Ras, RasGRP1-4, RasGRF1,2, CNrasGEF, and … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 13 658 RasGEFN domains in 12 887 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RasGEFN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RasGEFN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the RasGEFN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RasGEFN domain which could be assigned to a KEGG orthologous group, and not all proteins containing RasGEFN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000651
PfamRasGEFN