The RING domain within your query sequence starts at position 380 and ends at position 420, and its E-value is 9.09e-8.

CVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKGNRTCPIC
RING

RING

Ring finger
SMART ACC:SM000184
Description:E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
InterPro ACC:IPR001841
InterPro abstract:

This entry represents RING-type zinc finger domains. The RING-finger is a specialised type of Zn-finger of 40 to 60 residues that binds two atoms of zinc, and is probably involved in mediating protein-protein interactions [ PUBMED:8317827 PUBMED:8804826 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 308 772 RING domains in 276 130 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RING domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RING domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the RING domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the RING domain.

ProteinDescriptionDisease / phenotype
PEX10_HUMANOMIM:602859 : Zellweger syndrome
OMIM:214100 : Adrenoleukodystrophy, neonatal
OMIM:202370 : no description
BRCA1_HUMANOMIM:113705 : Breast cancer-1 ; Ovarian cancer ; Breast-ovarian cancer ; Papillary serous carcinoma of the peritoneum

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RING domain which could be assigned to a KEGG orthologous group, and not all proteins containing RING domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001841