The RHO domain within your query sequence starts at position 12 and ends at position 185, and its E-value is 5.31e-124.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 11995995 ) for details.

CVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPVCVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTP
RHO

RHO

Rho (Ras homology) subfamily of Ras-like small GTPases
SMART ACC:SM000174
Description:Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.
InterPro ACC:IPR001806
InterPro abstract:

Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [ PUBMED:2122258 PUBMED:1898771 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 13 543 RHO domains in 13 489 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RHO domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RHO domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:GTP-hydrolysis

Relevant references for this domain

Primary literature for the RHO domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the RHO domain.

ProteinDescriptionDisease / phenotype
RASK_HUMANOMIM:190070 : Colorectal adenoma ; Colorectal cancer
RRAS2_HUMANOMIM:600098 : ONCOGENE TC21
RASH_HUMANOMIM:190020 : Bladder cancer
OMIM:109800 : no description
RASN_HUMANOMIM:164790 : Colorectal cancer
RB27A_HUMANOMIM:603868 : Griscelli syndrome
OMIM:214450 : no description
A0A024RAV5_HUMANOMIM:190070 : Colorectal adenoma ; Colorectal cancer

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RHO domain which could be assigned to a KEGG orthologous group, and not all proteins containing RHO domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001806