The DEFSN domain within your query sequence starts at position 37 and ends at position 67, and its E-value is 3.54e-2.

CYKFGGFCYNSMCPPHTKFIGNCHPDHLHCC
DEFSN

DEFSN

Defensin/corticostatin family
SMART ACC:SM000048
Description:Cysteine-rich domains that lyse bacteria, fungi and enveloped viruses by forming multimeric membrane-spanning channels.
InterPro ACC:IPR006080
InterPro abstract:

This is a cysteine-rich domain found at the C-terminal end of alpha and beta defensins mainly from mammals that lyse bacteria, fungi and enveloped viruses by forming multimeric membrane-spanning channels.

Defensins are 2-6kDa, cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses [ PUBMED:8528769 expand

GO process:defense response (GO:0006952)
GO component:extracellular region (GO:0005576)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 582 DEFSN domains in 571 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DEFSN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DEFSN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DEFSN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DEFSN domain which could be assigned to a KEGG orthologous group, and not all proteins containing DEFSN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006080
PROSITEDEFSN_DOMAIN
Pfamdefensins