The LamGL domain within your query sequence starts at position 114 and ends at position 263, and its E-value is 1.55e-54.

DAFTLQVWLRAEGGQKSPAVITGLYDKCSYTSRDRGWVMGIHTTSDQGNRDPRYFFSLKTDRARKVTTIDAHRSYLPGQWVHLAATYDGRLMKLYMNGAQVATSAEQVGGIFSPLTQKCKVLMLGGSALNHNFRGHIEHFSLWKVARTQR
LamGL

LamGL

LamG-like jellyroll fold domain
SMART ACC:SM000560
Description: -
InterPro ACC:IPR006558
InterPro abstract:

This LamG-like jellyroll fold domain is found in the metalloproteinase Pappalysin-1 [ PUBMED:17314100 ] and Usherin [ PUBMED:17360538 ]. Its function is unknown.

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 130 LamGL domains in 997 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LamGL domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LamGL domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the LamGL domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LamGL domain which could be assigned to a KEGG orthologous group, and not all proteins containing LamGL domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006558