The BBOX domain within your query sequence starts at position 149 and ends at position 196, and its E-value is 2.97e-12.

DANQCCTSCEDNAPATSYCVECSEPLCETCVEAHQRVKYTKDHTVRST
BBOX

BBOX

B-Box-type zinc finger
SMART ACC:SM000336
Description: -
InterPro ACC:IPR000315
InterPro abstract:

This entry represents B-box-type zinc finger domains, which are around 40 residues in length.

B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box … expand

GO function:zinc ion binding (GO:0008270)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 44 632 BBOX domains in 32 803 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BBOX domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BBOX domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BBOX domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the BBOX domain.

ProteinDescriptionDisease / phenotype
MEFV_HUMANOMIM:249100 : Familial Mediterranean fever

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BBOX domain which could be assigned to a KEGG orthologous group, and not all proteins containing BBOX domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamzf-B_box
InterProIPR000315