The SANT domain within your query sequence starts at position 742 and ends at position 794, and its E-value is 9.48e-6.

DDEEWSEQELQKLHCAFTSLPKHKPGFWSDVAMAVGSRTADECQKKYTEEPQG
SANT

SANT

SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains
SMART ACC:SM000717
Description: -
InterPro ACC:IPR001005
InterPro abstract:

The myb/SANT domains can be classified into three groups: the myb-type HTH domain, which binds DNA, the SANT domain, which is a protein-protein interaction module, and the myb-like domain that can be involved in either of these functions. This entry represents a myb-like domain.

The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins. In … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 139 666 SANT domains in 88 628 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SANT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SANT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:DNA-binding

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SANT domain which could be assigned to a KEGG orthologous group, and not all proteins containing SANT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001005