The Ca_chan_IQ domain within your query sequence starts at position 1249 and ends at position 1282, and its E-value is 3.71e-14.

DDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRP
Ca_chan_IQ

Ca_chan_IQ

Voltage gated calcium channel IQ domain
SMART ACC:SM001062
Description:Voltage gated calcium channels control cellular calcium entry in response to changes in membrane potential. The isoleucine-glutamine (IQ) motif in the voltage gated calcium channel IQ domain interacts with hydrophobic pockets of Ca2+/calmodulin (PUBMED:16299511). The interaction regulates two self-regulatory calcium dependent feedback mechanism, calcium dependent inactivation (CDI), and calcium-dependent facilitation (CDF).
InterPro ACC:IPR014873
InterPro abstract:

Ca2+ ions are unique in that they not only carry charge but they are also the most widely used of diffusible second messengers. Voltage-dependent Ca2+ channels (VDCC) are a family of molecules that allow cells to couple electrical activity to intracellular Ca2+ signalling. The opening and closing of these channels by depolarizing stimuli, such as action potentials, allows Ca2+ ions to enter neurons … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 198 Ca_chan_IQ domains in 5 178 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Ca_chan_IQ domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Ca_chan_IQ domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the Ca_chan_IQ domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Ca_chan_IQ domain which could be assigned to a KEGG orthologous group, and not all proteins containing Ca_chan_IQ domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR014873
PfamCa_chan_IQ