The MAPKK1_Int domain within your query sequence starts at position 3 and ends at position 121, and its E-value is 6.65e-63.

DDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELIKVV
MAPKK1_Int

MAPKK1_Int

Mitogen-activated protein kinase kinase 1 interacting
SMART ACC:SM001278
Description:Mitogen-activated protein kinase kinase 1 interacting protein is a small subcellular adaptor protein required for MAPK signaling and ERK1/2 activation. The overall topology of this domain has a central five-stranded beta-sheet sandwiched between a two alpha-helix and a one alpha-helix layer PMID:15263099.
InterPro ACC:IPR015019
InterPro abstract:

Ragulator complex protein LAMTOR3 (for lysosomal adaptor and MAPK and MTOR activator 3) is a regulator of the TOR pathway, which is a signalling cascade that promotes cell growth in response to growth factors, energy levels, and amino acids [ PUBMED:19539012 ].

GO process:regulation of TOR signaling (GO:0032006)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 566 MAPKK1_Int domains in 564 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MAPKK1_Int domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MAPKK1_Int domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the MAPKK1_Int domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MAPKK1_Int domain which could be assigned to a KEGG orthologous group, and not all proteins containing MAPKK1_Int domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR015019
PfamMAPKK1_Int