The FERM_C domain within your query sequence starts at position 160 and ends at position 229, and its E-value is 1.23e0.

DEAEMEYLKIAQDLEMYGVNYFTIRFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADS
FERM_C

FERM_C

FERM C-terminal PH-like domain
SMART ACC:SM001196
Description: -
InterPro ACC:IPR018980
InterPro abstract:

This entry represents the PH-like domain found at the C terminus of the FERM domain.

The FERM domain (F for 4.1 protein, E for ezrin, R for radixin and M for moesin) is a widespread protein module involved in localising proteins to the plasma membrane [ PUBMED:9757824 ]. FERM domains are found in a number of cytoskeletal-associated … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 19 964 FERM_C domains in 19 942 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FERM_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FERM_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the FERM_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FERM_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing FERM_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR018980
PfamFERM_C