The ZnF_C4 domain within your query sequence starts at position 104 and ends at position 177, and its E-value is 2.88e-36.

DELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKSLHPSYSCKYEGKCIIDKVTRNQCQECRFKKCIYVGMATD
ZnF_C4

ZnF_C4

c4 zinc finger in nuclear hormone receptors
SMART ACC:SM000399
Description: -
InterPro ACC:IPR001628
InterPro abstract:

This entry represents the two C4-type zinc finger modules involved in DNA-binding.

Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis. The receptors function as dimeric molecules in nuclei to regulate … expand

GO process:regulation of DNA-templated transcription (GO:0006355)
GO function:DNA-binding transcription factor activity (GO:0003700), zinc ion binding (GO:0008270), sequence-specific DNA binding (GO:0043565)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 29 577 ZnF_C4 domains in 29 290 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZnF_C4 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZnF_C4 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ZnF_C4 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the ZnF_C4 domain.

ProteinDescriptionDisease / phenotype
STF1_HUMANOMIM:184757 : Sex reversal, XY, with adrenal failure ; Adrenocortical insufficiency without ovarian defect
NR2E3_HUMANOMIM:604485 : Enhanced S-cone syndrome
OMIM:268100 : Retinitis pigmentosa, late onset
OMIM:268000 : no description
VDR_HUMANOMIM:601769 : Rickets, vitamin D-resistant
OMIM:277440 : ?Osteoporosis, involutional
ANDR_HUMANOMIM:313700 : Androgen insensitivity, several forms ; Spinal and bulbar muscular atrophy of Kennedy
OMIM:313200 : Prostate cancer ; Perineal hypospadias ; Breast cancer, male, with Reifenstein syndrome

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZnF_C4 domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZnF_C4 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITENUCLEAR_RECEPTOR
InterProIPR001628
Pfamzf-C4