The IFabd domain within your query sequence starts at position 58 and ends at position 175, and its E-value is 6.97e-74.

DFGFPQEKVGAQQIQEAQAIPVLSELTQQVLNIFTSKDSSAAWNATLLDSFCNEVHQQLNDLKACVMQQVGVQESPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRAL
IFabd

IFabd

Interferon alpha, beta and delta.
SMART ACC:SM000076
Description:Interferons produce antiviral and antiproliferative responses in cells. They are classified into five groups, all of them related but gamma-interferon.
InterPro ACC:IPR000471
InterPro abstract:
GO process:defense response (GO:0006952)
GO component:extracellular region (GO:0005576)
GO function:cytokine receptor binding (GO:0005126)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 209 IFabd domains in 2 202 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IFabd domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IFabd domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IFabd domain which could be assigned to a KEGG orthologous group, and not all proteins containing IFabd domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000471
PROSITEINTERFERON_A_B_D
Pfaminterferon