The RQC domain within your query sequence starts at position 923 and ends at position 1028, and its E-value is 3.2e-28.

DFGPQAFQLLSAVDILQEKFGIGIPILFLRGSNSQRLPDKYRGHRLFGAGKEQAESWWKTLSHHLIAEGFLVEVPKENKYIKTCSLTKKGRKWLGEASSQSPPSLL
RQC

RQC

SMART ACC:SM000956
Description:This DNA-binding domain is found in the RecQ helicase among others and has a helix-turn-helix structure. The RQC domain, found only in RecQ family enzymes, is a high affinity G4 DNA binding domain (PUBMED:16530788).
InterPro ACC:IPR018982
InterPro abstract:

This entry represents the RQC domain, which is a DNA-binding domain found only in RecQ family enzymes [ PUBMED:25901030 ]. RecQ family helicases can unwind G4 DNA, and play important roles at G-rich domains of the genome, including the telomeres, rDNA, and immunoglobulin switch regions. This domain has a helix-turn-helix … expand

GO process:DNA replication (GO:0006260), DNA repair (GO:0006281)
GO function:3'-5' DNA helicase activity (GO:0043138)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 16 583 RQC domains in 16 578 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RQC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RQC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport
Binding / catalysis:DNA-binding

Relevant references for this domain

Primary literature for the RQC domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RQC domain which could be assigned to a KEGG orthologous group, and not all proteins containing RQC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamRQC
InterProIPR018982