The EMP24_GP25L domain within your query sequence starts at position 35 and ends at position 160, and its E-value is 9.65e-10.

DFTFTLPAGRKECFYQPMPLKASLEIEYQVLDGGELDIDFHLTSPEGRTLVFEQRKSDGVHTIETEDGDYMFCFDNTFSTISEKVIFFELILDNMGEEVQGQEDWKKYITNTDVLEMKLEDILVSR
EMP24_GP25L

EMP24_GP25L

emp24/gp25L/p24 family/GOLD
SMART ACC:SM001190
Description:Members of this family are implicated in bringing cargo forward from the ER and binding to coat proteins by their cytoplasmic domains. This domain corresponds closely to the beta-strand rich GOLD domain described in (PUBMED:12049664). The GOLD domain is always found combined with lipid- or membrane-association domains (PUBMED:12049664).
InterPro ACC:IPR009038
InterPro abstract:

The GOLD (for Golgi dynamics) domain is a protein module found in several eukaryotic Golgi and lipid-traffic proteins. It is typically between 90 and 150 amino acids long. Most of the size difference observed in the GOLD-domain superfamily is traceable to a single large low-complexity insert that is seen in some versions of the domain. With the exception of the p24 proteins, which have a simple … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 982 EMP24_GP25L domains in 9 973 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing EMP24_GP25L domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing EMP24_GP25L domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the EMP24_GP25L domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a EMP24_GP25L domain which could be assigned to a KEGG orthologous group, and not all proteins containing EMP24_GP25L domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamEMP24_GP25L
InterProIPR009038