The NODP domain within your query sequence starts at position 1660 and ends at position 1722, and its E-value is 3.27e-30.

DIRGSIVYLEIDNRQCVQSSSQCFQSATDVAAFLGALASLGSLNIPYKIEAVKSEPVEPPLPS
NODP

NODP

SMART ACC:SM001339
Description:NOTCH signalling plays a fundamental role during a great number of developmental processes in multicellular animals (PMID:10221902, 11112321). NOD and NODP represent a region present in many NOTCH proteins and NOTCH homologs in multiple species such as NOTCH2 and NOTCH3, LIN12, SC1 and TAN1. The role of the NOD and NODP domains remains to be elucidated.
InterPro ACC:IPR011656
InterPro abstract:

NOTCH signalling plays a fundamental role during a great number of developmental processes in multicellular animals [ PUBMED:10221902 ]. NOD and NODP represent a region present in many NOTCH proteins and NOTCH homologues in multiple species such as NOTCH2 and NOTCH3, LIN12, SC1 and TAN1. The role of the NOD and NODP … expand

GO process:Notch signaling pathway (GO:0007219), cell differentiation (GO:0030154), multicellular organism development (GO:0007275)
GO component:membrane (GO:0016020)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 595 NODP domains in 1 593 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing NODP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing NODP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the NODP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a NODP domain which could be assigned to a KEGG orthologous group, and not all proteins containing NODP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamNODP
InterProIPR011656