The GAS2 domain within your query sequence starts at position 1330 and ends at position 1408, and its E-value is 9.8e-56.

DKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRAKG
GAS2

GAS2

Growth-Arrest-Specific Protein 2 Domain
SMART ACC:SM000243
Description:GROWTH-ARREST-SPECIFIC PROTEIN 2 Domain
InterPro ACC:IPR003108
InterPro abstract:

The GAR (Gas2-related) domain is common in plakin family members and Gas2 family members. It has been shown to bind to microtubules [ PUBMED:20335501 PUBMED:11112700 PUBMED:11854008 expand

GO function:microtubule binding (GO:0008017)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 847 GAS2 domains in 2 844 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GAS2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GAS2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the GAS2 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GAS2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing GAS2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003108