The Gp_dh_N domain within your query sequence starts at position 2 and ends at position 152, and its E-value is 3e-96.

DKIGMDGFGRIGHLVTRAAFCSALGKVETVAIKNPFIDLNYMVYMFQSDSTHGKFNGTVKAENGKLVINGKPITIFQERDPANIKWGNAGAEYVMESTGVFTTTEKAGAHLKGGAKKVIISAPSANAPMLVMVVNHEKYDNSLKIVSNASC
Gp_dh_N

Gp_dh_N

Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
SMART ACC:SM000846
Description:GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. N-terminal domain is a Rossmann NAD(P) binding fold.
InterPro ACC:IPR020828
InterPro abstract:

Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [ PUBMED:2716055 ] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate. The enzyme exists as a tetramer of identical subunits, each containing 2 conserved … expand

GO function:NAD binding (GO:0051287)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 40 221 Gp_dh_N domains in 40 205 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Gp_dh_N domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Gp_dh_N domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the Gp_dh_N domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Gp_dh_N domain which could be assigned to a KEGG orthologous group, and not all proteins containing Gp_dh_N domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamGp_dh_N
InterProIPR020828