The DM10 domain within your query sequence starts at position 239 and ends at position 359, and its E-value is 3.04e-59.

DKQVLRFYAIWDDTDSLFGECRHYIIHYYLMDDTVEIREVHERNNGRDPFPLLMNRQRMPKVLVENAKNFPKCVLEISDQEVLEWYTAKDFIVGKPLTILGRTFFIYDCDPFTRQFYKDKF
DM10

DM10

Domains in hypothetical proteins in Drosophila, C. elegans and mammals. Occurs singly in some nucleoside diphosphate kinases.
SMART ACC:SM000676
Description: -
InterPro ACC:IPR006602
InterPro abstract:

This entry represents the DM10 domain, which consists of approximately 105 residues whose function is unknown. The DM10 domain has been identified in only two types of proteins: nucleoside diphosphate kinases (which contain a single copy of the DM10 domain) and in an uncharacterised class of proteins (which contain multiple copies of DM10 domains).

The nm23-H7 class of nucleoside diphosphate … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 505 DM10 domains in 1 893 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DM10 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DM10 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription
Binding / catalysis:Unknown

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DM10 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DM10 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006602